PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400009823
Common NameLOC102593360
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family WRKY
Protein Properties Length: 511aa    MW: 56376.1 Da    PI: 7.021
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400009823genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY98.54.3e-31224280259
                           --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           +DgynWrKYGqK+vk se+prsYY+Ct+ +Cpvkkkvers  d+ ++eitY+g+Hnhe
  PGSC0003DMP400009823 224 SDGYNWRKYGQKMVKASECPRSYYKCTHVKCPVKKKVERSI-DGYITEITYKGHHNHE 280
                           7****************************************.***************7 PP

2WRKY104.94.2e-33397455159
                           ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           ldDg++WrKYGqK+vkg+++prsYYrCt++gC+v+k+ver++ dpk+v++tYeg+Hnh+
  PGSC0003DMP400009823 397 LDDGFKWRKYGQKVVKGNHHPRSYYRCTYPGCNVRKHVERASADPKAVITTYEGKHNHD 455
                           59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081122.928218282IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.6E-27218282IPR003657WRKY domain
SuperFamilySSF1182909.29E-25222282IPR003657WRKY domain
SMARTSM007744.7E-33223281IPR003657WRKY domain
PfamPF031063.2E-23225280IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.3E-36383457IPR003657WRKY domain
SuperFamilySSF1182901.83E-29389457IPR003657WRKY domain
PROSITE profilePS5081135.898392457IPR003657WRKY domain
SMARTSM007741.2E-39397456IPR003657WRKY domain
PfamPF031068.3E-26398455IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 511 aa     Download sequence    Send to blast
MGEKFKAPSV SVSSLSTLTI PPKAPFESFF GVGNIPYFSP GPMTLVSSFF SESEYPSFSQ  60
LLAGAMASPL AKPPTLLPEN SSGEEENCKQ GNLGYKQNRP MNLMVAQSPF FTIPTAFSPS  120
GLLNSPGFLS PLQSPFGMSH QQALAHVTAQ AALSQSYLQT QAECHFSSQS TSAQVLGASD  180
PEESSLQPQL DTMSSDQKIK KFELPQLSQS EDKPSFNSVD RPASDGYNWR KYGQKMVKAS  240
ECPRSYYKCT HVKCPVKKKV ERSIDGYITE ITYKGHHNHE LPQPNKRRRD SCAQDGSDCS  300
NINPEIGTHT EIEINGLNGA LVAHSEQVST EMACERPVSN ECEEIEDAAT AAGKEHDDEP  360
NVKRMKTTVE TPILSSSHKA ESESKIVVQT RSEVDILDDG FKWRKYGQKV VKGNHHPRSY  420
YRCTYPGCNV RKHVERASAD PKAVITTYEG KHNHDIPIAR NRSHSTAQNS SRQLNEQEIA  480
TCRPSLLEKV ALHTNEIPVC RQLKEEHIAA *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-35225457877Probable WRKY transcription factor 4
2lex_A3e-35225457877Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB7111260.0AB711126.1 Solanum tuberosum StWRKY14 mRNA for transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006350164.10.0PREDICTED: probable WRKY transcription factor 4 isoform X2
TrEMBLM1A3W00.0M1A3W0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000142200.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.11e-120WRKY DNA-binding protein 4
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]